Lineage for d1ivdb_ (1ivd B:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 proteins)
  6. Protein Influenza neuraminidase [50943] (9 species)
  7. Species Influenza A virus, different strains [TaxId:11320] [50944] (89 PDB entries)
    Uniprot P03472 84-470
  8. Domain d1ivdb_: 1ivd B: [118513]
    duplicate of 1IVD
    complexed with ca, st1

Details for d1ivdb_

PDB Entry: 1ivd (more details), 1.9 Å

PDB Description: structures of aromatic inhibitors of influenza virus neuraminidase
PDB Compounds: (B:) influenza a subtype n2 neuraminidase

SCOPe Domain Sequences for d1ivdb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ivdb_ b.68.1.1 (B:) Influenza neuraminidase {Influenza A virus, different strains [TaxId: 11320]}
veyrnwskpqcqitgfapfskdnsirlsaggdiwvtrepyvscdpvkcyqfalgqgttld
nkhsndtvhdriphrtllmnelgvpfhlgtrqvciawsssschdgkawlhvcitgddkna
tasfiydgrlvdsigswsqnilrtqesecvcingtctvvmtdgsasgradtrilfieegk
ivhisplagsaqhveecscyprypgvrcicrdnwkgsnrpvvdinmedysidssyvcsgl
vgdtprnddrssnsncrdpnnergtqgvkgwafdngndlwmgrtiskdlrsgyetfkvig
gwstpnsksqinrqvivdsdnrsgysgifsvegkscinrcfyvelirgrkqetrvwwtsn
sivvfcgtsgtygtgswpdganinfmpi

SCOPe Domain Coordinates for d1ivdb_ are not available.

Timeline for d1ivdb_:

Domains from other chains:
(mouse over for more information)
d1ivda_