Lineage for d1ivcb_ (1ivc B:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 959648Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 959649Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 959650Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 proteins)
  6. 959663Protein Influenza neuraminidase [50943] (2 species)
  7. 959664Species Influenza A virus, different strains [TaxId:11320] [50944] (54 PDB entries)
    Uniprot P03472 84-470
  8. 959711Domain d1ivcb_: 1ivc B: [118512]
    duplicate of 1IVC
    complexed with ca, st2

Details for d1ivcb_

PDB Entry: 1ivc (more details), 2.4 Å

PDB Description: structures of aromatic inhibitors of influenza virus neuraminidase
PDB Compounds: (B:) influenza a subtype n2 neuraminidase

SCOPe Domain Sequences for d1ivcb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ivcb_ b.68.1.1 (B:) Influenza neuraminidase {Influenza A virus, different strains [TaxId: 11320]}
veyrnwskpqcqitgfapfskdnsirlsaggdiwvtrepyvscdpvkcyqfalgqgttld
nkhsndtvhdriphrtllmnelgvpfhlgtrqvciawsssschdgkawlhvcitgddkna
tasfiydgrlvdsigswsqnilrtqesecvcingtctvvmtdgsasgradtrilfieegk
ivhisplagsaqhveecscyprypgvrcicrdnwkgsnrpvvdinmedysidssyvcsgl
vgdtprnddrssnsncrdpnnergtqgvkgwafdngndlwmgrtiskdlrsgyetfkvig
gwstpnsksqinrqvivdsdnrsgysgifsvegkscinrcfyvelirgrkqetrvwwtsn
sivvfcgtsgtygtgswpdganinfmpi

SCOPe Domain Coordinates for d1ivcb_:

Click to download the PDB-style file with coordinates for d1ivcb_.
(The format of our PDB-style files is described here.)

Timeline for d1ivcb_: