Lineage for d1hrbb_ (1hrb B:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 637916Fold a.24: Four-helical up-and-down bundle [47161] (27 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 638000Superfamily a.24.4: Hemerythrin [47188] (1 family) (S)
  5. 638001Family a.24.4.1: Hemerythrin [47189] (2 proteins)
    Iron-binding proteins
  6. 638002Protein Hemerythrin [47190] (2 species)
  7. 638003Species Phascolopsis gouldii [TaxId:6442] [47192] (3 PDB entries)
  8. 638021Domain d1hrbb_: 1hrb B: [118511]
    duplicate of 1HRB
    complexed with fe

Details for d1hrbb_

PDB Entry: 1hrb (more details), 5.5 Å

PDB Description: atomic models for the polypeptide backbones of myohemerythrin and hemerythrin
PDB Compounds: (B:) hemerythrin b

SCOP Domain Sequences for d1hrbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hrbb_ a.24.4.1 (B:) Hemerythrin {Phascolopsis gouldii [TaxId: 6442]}
gfpipdpyvwdpsfrtfysiiddehktlfngifhlaiddnadnlgelrrctgkhflnqev
lmeasqyqfydehkkehdgfinaldnwkgdvkwakawlvnhiktidfkykgki

SCOP Domain Coordinates for d1hrbb_:

Click to download the PDB-style file with coordinates for d1hrbb_.
(The format of our PDB-style files is described here.)

Timeline for d1hrbb_: