Lineage for d1hmvh_ (1hmv H:)

  1. Root: SCOP 1.73
  2. 742018Class e: Multi-domain proteins (alpha and beta) [56572] (53 folds)
  3. 743030Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 743031Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 743176Family e.8.1.2: Reverse transcriptase [56686] (2 proteins)
  6. 743177Protein HIV-1 reverse transcriptase [56689] (2 species)
  7. 743178Species Human immunodeficiency virus type 1 [TaxId:11676] [56690] (90 PDB entries)
  8. 743291Domain d1hmvh_: 1hmv H: [118510]
    Other proteins in same PDB: d1hmva1, d1hmvc1, d1hmve1, d1hmvg1
    duplicate of 1HMV B
    complexed with mg

Details for d1hmvh_

PDB Entry: 1hmv (more details), 3.2 Å

PDB Description: the structure of unliganded reverse transcriptase from the human immunodeficiency virus type 1
PDB Compounds: (H:) hiv-1 reverse transcriptase (subunit p51)

SCOP Domain Sequences for d1hmvh_:

Sequence, based on SEQRES records: (download)

>d1hmvh_ e.8.1.2 (H:) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1 [TaxId: 11676]}
ietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvfaik
kkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpldedf
rkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdiviyqym
ddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwtvqpi
vlpekdswtvndiqklvgklnwasqiypgikvrqlckllrgtkalteviplteeaelela
enreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrgahtnd
vkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntpplvk
lwy

Sequence, based on observed residues (ATOM records): (download)

>d1hmvh_ e.8.1.2 (H:) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1 [TaxId: 11676]}
ietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvfaik
kwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpldedfrkyta
ftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdiviyqymddlyv
gsdleigqhrtkieelrqhllrhpdkwtvqpivlpekdswtvndiqklvgklnwasqiyp
gikvrqlckllrgtkalteviplteeaelelaenreilkepvhgvyydpskdliaeiqkq
gqgqwtyqiyqepfknlktgkyarmrgahtndvkqlteavqkittesiviwgktpkfklp
iqketwetwwteywqatwipewefvntpplvklwy

SCOP Domain Coordinates for d1hmvh_:

Click to download the PDB-style file with coordinates for d1hmvh_.
(The format of our PDB-style files is described here.)

Timeline for d1hmvh_: