Lineage for d1guhd1 (1guh D:81-222)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. Protein Class alpha GST [81349] (8 species)
  7. Species Human (Homo sapiens), (a1-1) [TaxId:9606] [47625] (35 PDB entries)
    Uniprot P08263
  8. Domain d1guhd1: 1guh D:81-222 [118484]
    Other proteins in same PDB: d1guha2, d1guhb2, d1guhc2, d1guhd2
    duplicate of 1GUH A:81-222
    complexed with gsb

Details for d1guhd1

PDB Entry: 1guh (more details), 2.6 Å

PDB Description: Structure determination and refinement of human alpha class glutathione transferase A1-1, and a comparison with the MU and PI class enzymes
PDB Compounds: (D:) glutathione s-transferase a1-1

SCOPe Domain Sequences for d1guhd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1guhd1 a.45.1.1 (D:81-222) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]}
lygkdikeralidmyiegiadlgemilllpvcppeekdaklalikekiknryfpafekvl
kshgqdylvgnklsradihlvellyyveeldsslissfpllkalktrisnlptvkkflqp
gsprkppmdeksleearkifrf

SCOPe Domain Coordinates for d1guhd1 are not available.

Timeline for d1guhd1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1guhd2
View in 3D
Domains from other chains:
(mouse over for more information)
d1guha1, d1guha2, d1guhb1, d1guhb2, d1guhc1, d1guhc2