Lineage for d1guhc2 (1guh C:2-80)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1852416Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1852417Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1852841Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 1852852Protein Class alpha GST [81360] (8 species)
  7. 1852865Species Human (Homo sapiens), (a1-1) [TaxId:9606] [52870] (27 PDB entries)
    Uniprot P08263
  8. 1852926Domain d1guhc2: 1guh C:2-80 [118483]
    Other proteins in same PDB: d1guha1, d1guhb1, d1guhc1, d1guhd1
    duplicate of 1GUH A:2-80
    complexed with gsb

Details for d1guhc2

PDB Entry: 1guh (more details), 2.6 Å

PDB Description: Structure determination and refinement of human alpha class glutathione transferase A1-1, and a comparison with the MU and PI class enzymes
PDB Compounds: (C:) glutathione s-transferase a1-1

SCOPe Domain Sequences for d1guhc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1guhc2 c.47.1.5 (C:2-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]}
aekpklhyfnargrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
gmklvqtrailnyiaskyn

SCOPe Domain Coordinates for d1guhc2:

Click to download the PDB-style file with coordinates for d1guhc2.
(The format of our PDB-style files is described here.)

Timeline for d1guhc2: