Lineage for d1gsdc1 (1gsd C:81-209)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 641765Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 641766Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 641767Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)
  6. 641778Protein Class alpha GST [81349] (8 species)
  7. 641798Species Human (Homo sapiens), (a1-1) [TaxId:9606] [47625] (17 PDB entries)
  8. 641823Domain d1gsdc1: 1gsd C:81-209 [118474]
    Other proteins in same PDB: d1gsda2, d1gsdb2, d1gsdc2, d1gsdd2
    duplicate of 1GSD A:81-209

Details for d1gsdc1

PDB Entry: 1gsd (more details), 2.5 Å

PDB Description: glutathione transferase a1-1 in unliganded form
PDB Compounds: (C:) glutathione transferase a1-1

SCOP Domain Sequences for d1gsdc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gsdc1 a.45.1.1 (C:81-209) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]}
lygkdikeralidmyiegiadlgemilllpvcppeekdaklalikekiknryfpafekvl
kshgqdylvgnklsradihlvellyyveeldsslissfpllkalktrisnlptvkkflqp
gsprkppmd

SCOP Domain Coordinates for d1gsdc1:

Click to download the PDB-style file with coordinates for d1gsdc1.
(The format of our PDB-style files is described here.)

Timeline for d1gsdc1: