![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.8: The 'swivelling' beta/beta/alpha domain [52008] (10 superfamilies) 3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology this domain is thought to be mobile in most multi-domain proteins known to contain it |
![]() | Superfamily c.8.5: GroEL apical domain-like [52029] (3 families) ![]() |
![]() | Family c.8.5.1: GroEL-like chaperone, apical domain [52030] (2 proteins) |
![]() | Protein GroEL, A domain [52031] (4 species) |
![]() | Species Escherichia coli [TaxId:562] [52032] (18 PDB entries) |
![]() | Domain d1grle2: 1grl E:191-366 [118466] Other proteins in same PDB: d1grla1, d1grla3, d1grlb1, d1grlb3, d1grlc1, d1grlc3, d1grld1, d1grld3, d1grle1, d1grle3, d1grlf1, d1grlf3, d1grlg1, d1grlg3 duplicate of 1GRL 191-366 |
PDB Entry: 1grl (more details), 2.8 Å
SCOPe Domain Sequences for d1grle2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1grle2 c.8.5.1 (E:191-366) GroEL, A domain {Escherichia coli [TaxId: 562]} egmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagkpllii aedvegealatavvntmrgivkvaavkapgfgdrrkamlqdiatltggtviseeigmele katledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdydreklq
Timeline for d1grle2: