Lineage for d1grlc1 (1grl C:6-136,C:410-523)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2345324Fold a.129: GroEL equatorial domain-like [48591] (1 superfamily)
    multihelical; 8 helices arranged in 2 parallel layers
  4. 2345325Superfamily a.129.1: GroEL equatorial domain-like [48592] (2 families) (S)
    duplication: two 4-helical subdomains are related by a pseudo dyad passing through the ATP-binding site
  5. 2345326Family a.129.1.1: GroEL chaperone, ATPase domain [48593] (1 protein)
  6. 2345327Protein GroEL, E domain [48594] (4 species)
  7. 2345328Species Escherichia coli [TaxId:562] [48595] (11 PDB entries)
  8. 2345436Domain d1grlc1: 1grl C:6-136,C:410-523 [118459]
    Other proteins in same PDB: d1grla2, d1grla3, d1grlb2, d1grlb3, d1grlc2, d1grlc3, d1grld2, d1grld3, d1grle2, d1grle3, d1grlf2, d1grlf3, d1grlg2, d1grlg3
    duplicate of 1GRL 6-136,410-523

Details for d1grlc1

PDB Entry: 1grl (more details), 2.8 Å

PDB Description: the crystal structure of the bacterial chaperonin groel at 2.8 angstroms
PDB Compounds: (C:) groEL (hsp60 class)

SCOPe Domain Sequences for d1grlc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1grlc1 a.129.1.1 (C:6-136,C:410-523) GroEL, E domain {Escherichia coli [TaxId: 562]}
vkfgndagvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareieledk
fenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgidkavt
vaveelkalsvXgvvagggvalirvaskladlrgqnedqnvgikvalrameaplrqivln
cgeepsvvantvkggdgnygynaateeygnmidmgildptkvtrsalqyaasvaglmitt
ecmvtd

SCOPe Domain Coordinates for d1grlc1:

Click to download the PDB-style file with coordinates for d1grlc1.
(The format of our PDB-style files is described here.)

Timeline for d1grlc1: