Lineage for d1fdhh_ (1fdh H:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2687001Protein Hemoglobin, beta-chain [46500] (26 species)
  7. 2687742Species Human fetus (Homo sapiens), gamma-chain [TaxId:9606] [46502] (3 PDB entries)
  8. 2687748Domain d1fdhh_: 1fdh H: [118455]
    Other proteins in same PDB: d1fdha_, d1fdhb_
    complexed with hem

Details for d1fdhh_

PDB Entry: 1fdh (more details), 2.5 Å

PDB Description: structure of human foetal deoxyhaemoglobin
PDB Compounds: (H:) hemoglobin f (deoxy) (gamma chain)

SCOPe Domain Sequences for d1fdhh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fdhh_ a.1.1.2 (H:) Hemoglobin, beta-chain {Human fetus (Homo sapiens), gamma-chain [TaxId: 9606]}
ghfteedkatitslwgkvnvedaggetlgrllvvypwtqrffdsfgnlssasaimgnpkv
kahgkkvltslgdaikhlddlkgtfaqlselhcdklhvdpenfkllgnvlvtvlaihfgk
eftpevqaswqkmvtgvasalssryh

SCOPe Domain Coordinates for d1fdhh_:

Click to download the PDB-style file with coordinates for d1fdhh_.
(The format of our PDB-style files is described here.)

Timeline for d1fdhh_: