Class a: All alpha proteins [46456] (290 folds) |
Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (9 families) covalently-bound heme completes the core |
Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins) |
Protein Mitochondrial cytochrome c [46642] (7 species) |
Species Bonito (Katsuwonus pelamis) [TaxId:8226] [46647] (1 PDB entry) |
Domain d1cycb_: 1cyc B: [118450] duplicate of 1CYC complexed with hec |
PDB Entry: 1cyc (more details), 2.3 Å
SCOPe Domain Sequences for d1cycb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cycb_ a.3.1.1 (B:) Mitochondrial cytochrome c {Bonito (Katsuwonus pelamis) [TaxId: 8226]} gdvakgkktfvqkcaqchtvenggkhkvgpnlwglfgrktgqaegysytdankskgivwn entlmeylenpkkyipgtkmifagikkkgerqdlvaylksats
Timeline for d1cycb_: