SCOPe 2.07: Domain d1cerb1: 1cer B:1-148,B:313-333

Lineage for d1cerb1 (1cer B:1-148,B:313-333)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
   family members also share a common alpha+beta fold in C-terminal domain

6. Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (21 species)

7. Species Thermus aquaticus [TaxId:271] [51804] (2 PDB entries)

8. Domain d1cerb1: 1cer B:1-148,B:313-333 [118444]
   Other proteins in same PDB: d1cera2, d1cerb2, d1cerc2, d1cerd2, d1cero2, d1cerp2, d1cerq2, d1cerr2
   duplicate of 1CER O:1-148,O:313-333
   complexed with nad

Details for d1cerb1

PDB Entry: 1cer, 2.5 Å

PDB Description: determinants of enzyme thermostability observed in the molecular structure of thermus aquaticus d-glyceraldehyde-3-phosphate dehydrogenase at 2.5 angstroms resolution

PDB Compounds: (B:) holo-d-glyceraldehyde-3-phosphate dehydrogenase

SCOPe Domain Sequences for d1cerb1:

Sequence; same for both SEQRES and ATOM records:

>d1cerb1 c.2.1.3 (B:1-148,B:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]}
mkvgingfgrigrqvfrilhsrgvevalindltdnktlahllkydsiyhrfpgevayddq
ylyvdgkairatavkdpkeipwaeagvgvviestgvftdadkakahleggakkviitapa
kgeditivmgvnheaydpsrhhiisnasXnewgyanrvadlvelvlrkgv

Timeline for d1cerb1:

• d1cerb1 first appeared in SCOP 1.73
  
• d1cerb1 appears in SCOPe 2.06
  
• d1cerb1 appears in the current release, SCOPe 2.08