Lineage for d1cera1 (1cer A:1-148,A:313-333)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (21 species)
  7. Species Thermus aquaticus [TaxId:271] [51804] (2 PDB entries)
  8. Domain d1cera1: 1cer A:1-148,A:313-333 [118442]
    Other proteins in same PDB: d1cera2, d1cerb2, d1cerc2, d1cerd2, d1cero2, d1cerp2, d1cerq2, d1cerr2
    duplicate of 1CER O:1-148,O:313-333
    complexed with nad

Details for d1cera1

PDB Entry: 1cer (more details), 2.5 Å

PDB Description: determinants of enzyme thermostability observed in the molecular structure of thermus aquaticus d-glyceraldehyde-3-phosphate dehydrogenase at 2.5 angstroms resolution
PDB Compounds: (A:) holo-d-glyceraldehyde-3-phosphate dehydrogenase

SCOPe Domain Sequences for d1cera1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cera1 c.2.1.3 (A:1-148,A:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]}
mkvgingfgrigrqvfrilhsrgvevalindltdnktlahllkydsiyhrfpgevayddq
ylyvdgkairatavkdpkeipwaeagvgvviestgvftdadkakahleggakkviitapa
kgeditivmgvnheaydpsrhhiisnasXnewgyanrvadlvelvlrkgv

SCOPe Domain Coordinates for d1cera1 are not available.

Timeline for d1cera1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1cera2
View in 3D
Domains from other chains:
(mouse over for more information)
d1cerb1, d1cerb2, d1cerc1, d1cerc2, d1cerd1, d1cerd2, d1cero1, d1cero2, d1cerp1, d1cerp2, d1cerq1, d1cerq2, d1cerr1, d1cerr2