Lineage for d1cdec_ (1cde C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892510Fold c.65: Formyltransferase [53327] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214567; strand 6 is antiparallel to the rest
  4. 2892511Superfamily c.65.1: Formyltransferase [53328] (2 families) (S)
  5. 2892512Family c.65.1.1: Formyltransferase [53329] (5 proteins)
  6. 2892519Protein Glycinamide ribonucleotide transformylase, GART [53330] (2 species)
  7. 2892520Species Escherichia coli [TaxId:562] [53331] (9 PDB entries)
  8. 2892535Domain d1cdec_: 1cde C: [118440]
    duplicate of 1CDE
    complexed with dzf, gar

Details for d1cdec_

PDB Entry: 1cde (more details), 2.5 Å

PDB Description: structures of apo and complexed escherichia coli glycinamide ribonucleotide transformylase
PDB Compounds: (C:) phosphoribosyl-glycinamide formyltransferase

SCOPe Domain Sequences for d1cdec_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cdec_ c.65.1.1 (C:) Glycinamide ribonucleotide transformylase, GART {Escherichia coli [TaxId: 562]}
mnivvlisgngsnlqaiidacktnkikgtvravfsnkadafglerarqagiathtliasa
fdsreaydreliheidmyapdvvvlagfmrilspafvshyagrllnihpsllpkypglht
hrqalengdeehgtsvhfvtdeldggpvilqakvpvfagdsedditarvqtqehaiyplv
iswfadgrlkmhenaawldgqrlppqgya

SCOPe Domain Coordinates for d1cdec_:

Click to download the PDB-style file with coordinates for d1cdec_.
(The format of our PDB-style files is described here.)

Timeline for d1cdec_: