Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.72: Ribokinase-like [53612] (3 superfamilies) core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest potential superfamily: members of this fold have similar functions but different ATP-binding sites |
Superfamily c.72.1: Ribokinase-like [53613] (6 families) has extra strand located between strands 2 and 3 |
Family c.72.1.2: Thiamin biosynthesis kinases [53620] (2 proteins) |
Protein Hydroxyethylthiazole kinase (THZ kinase, ThiK) [53621] (2 species) |
Species Bacillus subtilis [TaxId:1423] [53622] (5 PDB entries) |
Domain d1c3qb1: 1c3q B:1-272 [118437] Other proteins in same PDB: d1c3qa2, d1c3qb2, d1c3qc2 complexed with cl, tze |
PDB Entry: 1c3q (more details), 2 Å
SCOPe Domain Sequences for d1c3qb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c3qb1 c.72.1.2 (B:1-272) Hydroxyethylthiazole kinase (THZ kinase, ThiK) {Bacillus subtilis [TaxId: 1423]} mdaqsaakcltavrrhsplvhsitnnvvtnftangllalgaspvmayakeevadmakiag alvlnigtlskesveamiiagksanehgvpvildpvgagatpfrtesardiirevrlaai rgnaaeiahtvgvtdwlikgvdagegggdiirlaqqaaqklntviaitgevdviadtshv ytlhnghklltkvtgagclltsvvgafcaveenplfaaiaaissygvaaqlaaqqtadkg pgsfqiellnklstvteqdvqewatiervtvs
Timeline for d1c3qb1:
View in 3D Domains from other chains: (mouse over for more information) d1c3qa1, d1c3qa2, d1c3qc1, d1c3qc2 |