SCOPe 2.08: Domain d1c3qa1: 1c3q A:1-272

Lineage for d1c3qa1 (1c3q A:1-272)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.72: Ribokinase-like [53612] (3 superfamilies)
   core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
   potential superfamily: members of this fold have similar functions but different ATP-binding sites

4. Superfamily c.72.1: Ribokinase-like [53613] (6 families)
   has extra strand located between strands 2 and 3

5. Family c.72.1.2: Thiamin biosynthesis kinases [53620] (2 proteins)

6. Protein Hydroxyethylthiazole kinase (THZ kinase, ThiK) [53621] (2 species)

7. Species Bacillus subtilis [TaxId:1423] [53622] (5 PDB entries)

8. Domain d1c3qa1: 1c3q A:1-272 [118436]
   Other proteins in same PDB: d1c3qa2, d1c3qb2, d1c3qc2
   complexed with cl, tze

Details for d1c3qa1

PDB Entry: 1c3q, 2 Å

PDB Description: crystal structure of native thiazole kinase in the monoclinic form

PDB Compounds: (A:) hydroxyethylthiazole kinase

SCOPe Domain Sequences for d1c3qa1:

Sequence; same for both SEQRES and ATOM records:

>d1c3qa1 c.72.1.2 (A:1-272) Hydroxyethylthiazole kinase (THZ kinase, ThiK) {Bacillus subtilis [TaxId: 1423]}
mdaqsaakcltavrrhsplvhsitnnvvtnftangllalgaspvmayakeevadmakiag
alvlnigtlskesveamiiagksanehgvpvildpvgagatpfrtesardiirevrlaai
rgnaaeiahtvgvtdwlikgvdagegggdiirlaqqaaqklntviaitgevdviadtshv
ytlhnghklltkvtgagclltsvvgafcaveenplfaaiaaissygvaaqlaaqqtadkg
pgsfqiellnklstvteqdvqewatiervtvs

Timeline for d1c3qa1:

• d1c3qa1 first appeared in SCOP 1.73
  
• d1c3qa1 appears in SCOPe 2.07