SCOP 1.73: Domain d1bbjb2: 1bbj B:116-212

Lineage for d1bbjb2 (1bbj B:116-212)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88575] (150 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)

8. Domain d1bbjb2: 1bbj B:116-212 [118421]
   Other proteins in same PDB: d1bbja1, d1bbja2, d1bbjb1, d1bbjh1, d1bbjl1, d1bbjl2
   duplicate of 1BBJ H:116-212

Details for d1bbjb2

PDB Entry: 1bbj, 3.1 Å

PDB Description: crystal structure of a chimeric fab' fragment of an antibody binding tumour cells

PDB Compounds: (B:) igg4-kappa b72.3 fab (heavy chain)

SCOP Domain Sequences for d1bbjb2:

Sequence; same for both SEQRES and ATOM records:

>d1bbjb2 b.1.1.2 (B:116-212) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
stkgpsvfplapcsrstsestaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssg
lyslssvvtvpssslgtktytcnvdhkpsntkvdkrv

Timeline for d1bbjb2:

• d1bbjb2 is new in SCOP 1.73
  
• d1bbjb2 appears in SCOP 1.75
  
• d1bbjb2 appears in the current release, SCOPe 2.08