SCOPe 2.07: Domain d1bbja2: 1bbj A:110-211

Lineage for d1bbja2 (1bbj A:110-211)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88569] (151 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)
   SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody

8. Domain d1bbja2: 1bbj A:110-211 [118419]
   Other proteins in same PDB: d1bbja1, d1bbjb1, d1bbjb2, d1bbjh1, d1bbjh2, d1bbjl1
   duplicate of 1BBJ L:110-211

Details for d1bbja2

PDB Entry: 1bbj, 3.1 Å

PDB Description: crystal structure of a chimeric fab' fragment of an antibody binding tumour cells

PDB Compounds: (A:) igg4-kappa b72.3 fab (light chain)

SCOPe Domain Sequences for d1bbja2:

Sequence; same for both SEQRES and ATOM records:

>d1bbja2 b.1.1.2 (A:110-211) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
daaptvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdsk
dstyslsstltlskadyekhkvyacevthqglsspvtksfnr

Timeline for d1bbja2:

• d1bbja2 first appeared in SCOP 1.73
  
• d1bbja2 appears in SCOPe 2.06
  
• d1bbja2 appears in the current release, SCOPe 2.08