Lineage for d1bbja1 (1bbj A:1-109)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2353665Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2354271Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (231 PDB entries)
    Uniprot P01645 1-106 # 95% sequense identity; KV5L_MOUSE Ig kappa chain V-V region HP 93G7 ! SQ NA # natural chimera; best hits are: Uniprot P01637 (Ig kappa chain V-V region T1) and Uniprot P01837 (Ig kappa chain C region) ! SQ NA # humanized antibody ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01642 21-115 # ! KV5I_MOUSE Ig kappa chain V-V region L7 precursor
  8. 2354505Domain d1bbja1: 1bbj A:1-109 [118418]
    Other proteins in same PDB: d1bbja2, d1bbjb1, d1bbjb2, d1bbjh1, d1bbjh2, d1bbjl2
    duplicate of 1BBJ L:1-109

Details for d1bbja1

PDB Entry: 1bbj (more details), 3.1 Å

PDB Description: crystal structure of a chimeric fab' fragment of an antibody binding tumour cells
PDB Compounds: (A:) igg4-kappa b72.3 fab (light chain)

SCOPe Domain Sequences for d1bbja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bbja1 b.1.1.1 (A:1-109) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]}
diqmtqspaslsvsvgetvtitcraseniysnlawyqqkqgkspqllvyaatnladgvps
rfsgsgsgtqyslkinslqsedfgsyycqhfwgtpytfgggtrleikra

SCOPe Domain Coordinates for d1bbja1:

Click to download the PDB-style file with coordinates for d1bbja1.
(The format of our PDB-style files is described here.)

Timeline for d1bbja1: