Lineage for d1ausv_ (1aus V:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 726778Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 726779Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family) (S)
  5. 726780Family d.73.1.1: RuBisCO, small subunit [55240] (1 protein)
  6. 726781Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (8 species)
  7. 726842Species Spinach (Spinacia oleracea) [TaxId:3562] [55243] (8 PDB entries)
  8. 726866Domain d1ausv_: 1aus V: [118417]
    Other proteins in same PDB: d1ausl1, d1ausl2, d1ausm1, d1ausm2, d1ausn1, d1ausn2, d1auso1, d1auso2
    duplicate of 1AUS S
    complexed with cbx, mg

Details for d1ausv_

PDB Entry: 1aus (more details), 2.2 Å

PDB Description: activated unliganded spinach rubisco
PDB Compounds: (V:) ribulose bisphosphate carboxylase/oxygenase

SCOP Domain Sequences for d1ausv_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ausv_ d.73.1.1 (V:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea) [TaxId: 3562]}
mqvwpilnlkkyetlsylpplttdqlarqvdyllnnkwvpclefetdhgfvyrehhnspg
yydgrywtmwklpmfgctdpaqvlneleeckkeypnafiriigfdsnrevqcisfiaykp
agy

SCOP Domain Coordinates for d1ausv_:

Click to download the PDB-style file with coordinates for d1ausv_.
(The format of our PDB-style files is described here.)

Timeline for d1ausv_: