SCOPe 2.04: Domain d1aust_: 1aus T:

Lineage for d1aust_ (1aus T:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
   alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta

4. Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family)

5. Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins)

6. Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (8 species)

7. Species Spinach (Spinacia oleracea) [TaxId:3562] [55243] (10 PDB entries)

8. Domain d1aust_: 1aus T: [118415]
   Other proteins in same PDB: d1ausl1, d1ausl2, d1ausm1, d1ausm2, d1ausn1, d1ausn2, d1auso1, d1auso2
   duplicate of 1AUS S
   complexed with fmt, mg

Details for d1aust_

PDB Entry: 1aus, 2.2 Å

PDB Description: activated unliganded spinach rubisco

PDB Compounds: (T:) ribulose bisphosphate carboxylase/oxygenase

SCOPe Domain Sequences for d1aust_:

Sequence; same for both SEQRES and ATOM records:

>d1aust_ d.73.1.1 (T:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea) [TaxId: 3562]}
mqvwpilnlkkyetlsylpplttdqlarqvdyllnnkwvpclefetdhgfvyrehhnspg
yydgrywtmwklpmfgctdpaqvlneleeckkeypnafiriigfdsnrevqcisfiaykp
agy

Timeline for d1aust_:

• d1aust_ first appeared in SCOP 1.73
  
• d1aust_ appears in SCOPe 2.03
  
• d1aust_ appears in SCOPe 2.05
  
• d1aust_ appears in the current release, SCOPe 2.08