Lineage for d1aust_ (1aus T:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2524228Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 2524229Superfamily d.73.1: RuBisCO, small subunit [55239] (2 families) (S)
  5. 2524230Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins)
  6. 2524231Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (8 species)
  7. 2524308Species Spinach (Spinacia oleracea) [TaxId:3562] [55243] (10 PDB entries)
  8. 2524330Domain d1aust_: 1aus T: [118415]
    Other proteins in same PDB: d1ausl1, d1ausl2, d1ausm1, d1ausm2, d1ausn1, d1ausn2, d1auso1, d1auso2
    duplicate of 1AUS S
    complexed with fmt, mg

Details for d1aust_

PDB Entry: 1aus (more details), 2.2 Å

PDB Description: activated unliganded spinach rubisco
PDB Compounds: (T:) ribulose bisphosphate carboxylase/oxygenase

SCOPe Domain Sequences for d1aust_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aust_ d.73.1.1 (T:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea) [TaxId: 3562]}
mqvwpilnlkkyetlsylpplttdqlarqvdyllnnkwvpclefetdhgfvyrehhnspg
yydgrywtmwklpmfgctdpaqvlneleeckkeypnafiriigfdsnrevqcisfiaykp
agy

SCOPe Domain Coordinates for d1aust_:

Click to download the PDB-style file with coordinates for d1aust_.
(The format of our PDB-style files is described here.)

Timeline for d1aust_: