Lineage for d1ausn2 (1aus N:20-147)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) (S)
    C-terminal domain is beta/alpha barrel
  5. Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)
  6. Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (13 species)
  7. Species Spinach (Spinacia oleracea) [TaxId:3562] [54970] (11 PDB entries)
  8. Domain d1ausn2: 1aus N:20-147 [118412]
    Other proteins in same PDB: d1ausl1, d1ausm1, d1ausn1, d1auso1, d1auss_, d1aust_, d1ausu_, d1ausv_
    duplicate of 1AUS L:20-147
    complexed with fmt, mg

Details for d1ausn2

PDB Entry: 1aus (more details), 2.2 Å

PDB Description: activated unliganded spinach rubisco
PDB Compounds: (N:) ribulose bisphosphate carboxylase/oxygenase

SCOPe Domain Sequences for d1ausn2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ausn2 d.58.9.1 (N:20-147) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea) [TaxId: 3562]}
ykltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwttvwtdgltnldr
ykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfkalralrledlr
ipvayvkt

SCOPe Domain Coordinates for d1ausn2 are not available.

Timeline for d1ausn2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ausn1
View in 3D
Domains from other chains:
(mouse over for more information)
d1ausl1, d1ausl2, d1ausm1, d1ausm2, d1auso1, d1auso2, d1auss_, d1aust_, d1ausu_, d1ausv_