Lineage for d1ausn1 (1aus N:148-463)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2088460Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) (S)
    automatically mapped to Pfam PF00016
  5. 2088461Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 protein domains)
    N-terminal domain is alpha+beta
  6. 2088462Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [51651] (12 species)
  7. 2088560Species Spinach (Spinacia oleracea) [TaxId:3562] [51653] (11 PDB entries)
  8. 2088587Domain d1ausn1: 1aus N:148-463 [118411]
    Other proteins in same PDB: d1ausl2, d1ausm2, d1ausn2, d1auso2, d1auss_, d1aust_, d1ausu_, d1ausv_
    duplicate of 1AUS L:148-463
    complexed with fmt, mg

Details for d1ausn1

PDB Entry: 1aus (more details), 2.2 Å

PDB Description: activated unliganded spinach rubisco
PDB Compounds: (N:) ribulose bisphosphate carboxylase/oxygenase

SCOPe Domain Sequences for d1ausn1:

Sequence, based on SEQRES records: (download)

>d1ausn1 c.1.14.1 (N:148-463) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea) [TaxId: 3562]}
fqgpphgiqverdklnkygrpllgctikpklglsaknygravyeclrggldftkddenvn
sqpfmrwrdrflfcaealykaqaetgeikghylnatagtcedmmkravfarelgvpivmh
dyltggftanttlshycrdnglllhihramhavidrqknhgmhfrvlakalrlsggdhih
sgtvvgklegerditlgfvdllrddytekdrsrgiyftqswvstpgvlpvasggihvwhm
palteifgddsvlqfgggtlghpwgnapgavanrvaleacvqarnegrdlaregntiire
atkwspelaaacevwk

Sequence, based on observed residues (ATOM records): (download)

>d1ausn1 c.1.14.1 (N:148-463) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea) [TaxId: 3562]}
fqgpphgiqverdklnkygrpllgctikpklglsaknygravyeclrggldftkddenvn
sqpfmrwrdrflfcaealykaqaetgeikghylnatagtcedmmkravfarelgvpivmh
dyltggftanttlshycrdnglllhihramhavidrqknhgmhfrvlakalrlsggdhih
sgtvverditlgfvdllrddytekdrsrgiyftqswvstpgvlpvasggihvwhmpalte
ifgddsvlqfgggtlghpwgnapgavanrvaleacvqarnegrdlaregntiireatkws
pelaaacevwk

SCOPe Domain Coordinates for d1ausn1:

Click to download the PDB-style file with coordinates for d1ausn1.
(The format of our PDB-style files is described here.)

Timeline for d1ausn1: