![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
![]() | Superfamily h.3.3: Coronavirus S2 glycoprotein [111474] (1 family) ![]() |
![]() | Family h.3.3.1: Coronavirus S2 glycoprotein [111475] (1 protein) Pfam PF01601 |
![]() | Protein E2 spike glycoprotein [111476] (2 species) |
![]() | Species Human coronavirus (strain SARS) [TaxId:227859] [111478] (9 PDB entries) Uniprot P59594 896-972,1142-1183 Uniprot Q6UZF0 914-949,1148-1193 |
![]() | Domain d2bez.1: 2bez C:,F: [116716] complexed with gol |
PDB Entry: 2bez (more details), 1.6 Å
SCOPe Domain Sequences for d2bez.1:
Sequence; same for both SEQRES and ATOM records: (download)
>g2bez.1 h.3.3.1 (C:,F:) E2 spike glycoprotein {Human coronavirus (strain SARS) [TaxId: 227859]} nvlyenqkqianqfnkaisqiqesltttstalgklqdvvnqnaqalntlvkqlssnfgai ssvlndilsrldkveaeXtspdvdlgdisginasvvniqkeidrlnevaknlneslidlq
Timeline for d2bez.1: