Lineage for d2bez.1 (2bez C:,F:)

  1. Root: SCOP 1.75
  2. 894739Class h: Coiled coil proteins [57942] (7 folds)
  3. 895846Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 896087Superfamily h.3.3: Coronavirus S2 glycoprotein [111474] (1 family) (S)
  5. 896088Family h.3.3.1: Coronavirus S2 glycoprotein [111475] (1 protein)
    Pfam PF01601
  6. 896089Protein E2 spike glycoprotein [111476] (2 species)
  7. 896090Species Human coronavirus (strain SARS) [TaxId:227859] [111478] (9 PDB entries)
    Uniprot P59594 896-972,1142-1183
    Uniprot Q6UZF0 914-949,1148-1193
  8. 896100Domain d2bez.1: 2bez C:,F: [116716]

Details for d2bez.1

PDB Entry: 2bez (more details), 1.6 Å

PDB Description: structure of a proteolitically resistant core from the severe acute respiratory syndrome coronavirus s2 fusion protein
PDB Compounds: (C:) e2 glycoprotein, (F:) e2 glycoprotein

SCOP Domain Sequences for d2bez.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g2bez.1 h.3.3.1 (C:,F:) E2 spike glycoprotein {Human coronavirus (strain SARS) [TaxId: 227859]}
nvlyenqkqianqfnkaisqiqesltttstalgklqdvvnqnaqalntlvkqlssnfgai
ssvlndilsrldkveaeXtspdvdlgdisginasvvniqkeidrlnevaknlneslidlq

SCOP Domain Coordinates for d2bez.1:

Click to download the PDB-style file with coordinates for d2bez.1.
(The format of our PDB-style files is described here.)

Timeline for d2bez.1: