SCOP 1.73: Domain d2bez.1: 2bez C:,F:

Lineage for d2bez.1 (2bez C:,F:)

1. Root: SCOP 1.73

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.3: Coronavirus S2 glycoprotein [111474] (1 family)

5. Family h.3.3.1: Coronavirus S2 glycoprotein [111475] (1 protein)
   Pfam PF01601

6. Protein E2 spike glycoprotein [111476] (2 species)

7. Species Human coronavirus (strain SARS) [TaxId:227859] [111478] (9 PDB entries)

8. Domain d2bez.1: 2bez C:,F: [116716]

Details for d2bez.1

PDB Entry: 2bez, 1.6 Å

PDB Description: structure of a proteolitically resistant core from the severe acute respiratory syndrome coronavirus s2 fusion protein

PDB Compounds: (C:) e2 glycoprotein, (F:) e2 glycoprotein

SCOP Domain Sequences for d2bez.1:

Sequence; same for both SEQRES and ATOM records:

>g2bez.1 h.3.3.1 (C:,F:) E2 spike glycoprotein {Human coronavirus (strain SARS) [TaxId: 227859]}
nvlyenqkqianqfnkaisqiqesltttstalgklqdvvnqnaqalntlvkqlssnfgai
ssvlndilsrldkveaeXtspdvdlgdisginasvvniqkeidrlnevaknlneslidlq

Timeline for d2bez.1:

• d2bez.1 first appeared in SCOP 1.71
  
• d2bez.1 appears in SCOP 1.75
  
• d2bez.1 appears in the current release, SCOPe 2.08