Lineage for d2bete_ (2bet E:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2921985Fold c.121: Ribose/Galactose isomerase RpiB/AlsB [89622] (1 superfamily)
    3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 21354; topological similarity to a part of the arginase/deacetylase fold
  4. 2921986Superfamily c.121.1: Ribose/Galactose isomerase RpiB/AlsB [89623] (2 families) (S)
  5. 2921987Family c.121.1.1: Ribose/Galactose isomerase RpiB/AlsB [89624] (3 proteins)
    automatically mapped to Pfam PF02502
  6. 2921988Protein Alternate ribose 5-phosphate isomerase B, RpiB [89625] (2 species)
  7. 2921994Species Mycobacterium tuberculosis [TaxId:1773] [102273] (6 PDB entries)
    Uniprot Q79FD7
    Rv2465c
  8. 2922024Domain d2bete_: 2bet E: [116715]
    complexed with dez

Details for d2bete_

PDB Entry: 2bet (more details), 2.2 Å

PDB Description: structure of mycobacterium tuberculosis ribose-5-phosphate isomerase, rpib, rv2465c, in complex with 4-phospho-d-erythronate.
PDB Compounds: (E:) carbohydrate-phosphate isomerase

SCOPe Domain Sequences for d2bete_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bete_ c.121.1.1 (E:) Alternate ribose 5-phosphate isomerase B, RpiB {Mycobacterium tuberculosis [TaxId: 1773]}
gmrvylgadhagyelkqriiehlkqtghepidcgalrydadddypafciaaatrtvadpg
slgivlggsgngeqiaankvpgarcalawsvqtaalarehnnaqligiggrmhtvaeala
ivdafvttpwskaqrhqrridilaeyertheappvpga

SCOPe Domain Coordinates for d2bete_:

Click to download the PDB-style file with coordinates for d2bete_.
(The format of our PDB-style files is described here.)

Timeline for d2bete_: