Lineage for d2betb_ (2bet B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2169121Fold c.121: Ribose/Galactose isomerase RpiB/AlsB [89622] (1 superfamily)
    3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 21354; topological similarity to a part of the arginase/deacetylase fold
  4. 2169122Superfamily c.121.1: Ribose/Galactose isomerase RpiB/AlsB [89623] (2 families) (S)
  5. 2169123Family c.121.1.1: Ribose/Galactose isomerase RpiB/AlsB [89624] (3 proteins)
    automatically mapped to Pfam PF02502
  6. 2169124Protein Alternate ribose 5-phosphate isomerase B, RpiB [89625] (2 species)
  7. 2169130Species Mycobacterium tuberculosis [TaxId:1773] [102273] (6 PDB entries)
    Uniprot Q79FD7
    Rv2465c
  8. 2169157Domain d2betb_: 2bet B: [116712]
    complexed with dez

Details for d2betb_

PDB Entry: 2bet (more details), 2.2 Å

PDB Description: structure of mycobacterium tuberculosis ribose-5-phosphate isomerase, rpib, rv2465c, in complex with 4-phospho-d-erythronate.
PDB Compounds: (B:) carbohydrate-phosphate isomerase

SCOPe Domain Sequences for d2betb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2betb_ c.121.1.1 (B:) Alternate ribose 5-phosphate isomerase B, RpiB {Mycobacterium tuberculosis [TaxId: 1773]}
gmrvylgadhagyelkqriiehlkqtghepidcgalrydadddypafciaaatrtvadpg
slgivlggsgngeqiaankvpgarcalawsvqtaalarehnnaqligiggrmhtvaeala
ivdafvttpwskaqrhqrridilaeyertheappvpg

SCOPe Domain Coordinates for d2betb_:

Click to download the PDB-style file with coordinates for d2betb_.
(The format of our PDB-style files is described here.)

Timeline for d2betb_: