![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.121: Ribose/Galactose isomerase RpiB/AlsB [89622] (1 superfamily) 3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 21354; topological similarity to a part of the arginase/deacetylase fold |
![]() | Superfamily c.121.1: Ribose/Galactose isomerase RpiB/AlsB [89623] (2 families) ![]() |
![]() | Family c.121.1.1: Ribose/Galactose isomerase RpiB/AlsB [89624] (3 proteins) automatically mapped to Pfam PF02502 |
![]() | Protein Alternate ribose 5-phosphate isomerase B, RpiB [89625] (2 species) |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [102273] (6 PDB entries) Uniprot Q79FD7 Rv2465c |
![]() | Domain d2betb_: 2bet B: [116712] complexed with dez |
PDB Entry: 2bet (more details), 2.2 Å
SCOPe Domain Sequences for d2betb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2betb_ c.121.1.1 (B:) Alternate ribose 5-phosphate isomerase B, RpiB {Mycobacterium tuberculosis [TaxId: 1773]} gmrvylgadhagyelkqriiehlkqtghepidcgalrydadddypafciaaatrtvadpg slgivlggsgngeqiaankvpgarcalawsvqtaalarehnnaqligiggrmhtvaeala ivdafvttpwskaqrhqrridilaeyertheappvpg
Timeline for d2betb_:
![]() Domains from other chains: (mouse over for more information) d2beta_, d2betc_, d2betd_, d2bete_ |