| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.121: Ribose/Galactose isomerase RpiB/AlsB [89622] (1 superfamily) 3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 21354; topological similarity to a part of the arginase/deacetylase fold |
Superfamily c.121.1: Ribose/Galactose isomerase RpiB/AlsB [89623] (2 families) ![]() |
| Family c.121.1.1: Ribose/Galactose isomerase RpiB/AlsB [89624] (3 proteins) automatically mapped to Pfam PF02502 |
| Protein Alternate ribose 5-phosphate isomerase B, RpiB [89625] (2 species) |
| Species Mycobacterium tuberculosis [TaxId:1773] [102273] (6 PDB entries) Uniprot Q79FD7 Rv2465c |
| Domain d2besd_: 2bes D: [116709] complexed with res |
PDB Entry: 2bes (more details), 2.1 Å
SCOPe Domain Sequences for d2besd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2besd_ c.121.1.1 (D:) Alternate ribose 5-phosphate isomerase B, RpiB {Mycobacterium tuberculosis [TaxId: 1773]}
sgmrvylgadhagyelkqriiehlkqtghepidcgalrydadddypafciaaatrtvadp
gslgivlggsgngeqiaankvpgarcalawsvqtaalarehnnaqligiggrmhtvaeal
aivdafvttpwskaqrhqrridilaeyertheappvp
Timeline for d2besd_:
View in 3DDomains from other chains: (mouse over for more information) d2besa_, d2besb_, d2besc_, d2bese_ |