Lineage for d2besb_ (2bes B:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 595213Fold c.121: Ribose/Galactose isomerase RpiB/AlsB [89622] (1 superfamily)
    3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 21354; topological similarity to a part of the arginase/deacetylase fold
  4. 595214Superfamily c.121.1: Ribose/Galactose isomerase RpiB/AlsB [89623] (1 family) (S)
  5. 595215Family c.121.1.1: Ribose/Galactose isomerase RpiB/AlsB [89624] (2 proteins)
  6. 595216Protein Alternate ribose 5-phosphate isomerase B, RpiB [89625] (2 species)
  7. 595222Species Mycobacterium tuberculosis [TaxId:1773] [102273] (3 PDB entries)
    Rv2465c
  8. 595229Domain d2besb_: 2bes B: [116707]

Details for d2besb_

PDB Entry: 2bes (more details), 2.1 Å

PDB Description: structure of mycobacterium tuberculosis ribose-5-phosphate isomerase, rpib, rv2465c, in complex with 4-phospho-d-erythronohydroxamic acid.

SCOP Domain Sequences for d2besb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2besb_ c.121.1.1 (B:) Alternate ribose 5-phosphate isomerase B, RpiB {Mycobacterium tuberculosis}
sgmrvylgadhagyelkqriiehlkqtghepidcgalrydadddypafciaaatrtvadp
gslgivlggsgngeqiaankvpgarcalawsvqtaalarehnnaqligiggrmhtvaeal
aivdafvttpwskaqrhqrridilaeyertheappvp

SCOP Domain Coordinates for d2besb_:

Click to download the PDB-style file with coordinates for d2besb_.
(The format of our PDB-style files is described here.)

Timeline for d2besb_: