![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (21 proteins) domains of unknown function associated with different type of catalytic domains in a different sequential location subgroup of the larger IPT/TIG domain family |
![]() | Protein Chitin-binding protein CBP21 [117045] (1 species) member of Pfam PF03067; elaborated fold with a large insertion between strands A and A' |
![]() | Species Serratia marcescens [TaxId:615] [117046] (3 PDB entries) Uniprot O83009 28-197 |
![]() | Domain d2bemb_: 2bem B: [116699] complexed with edo, na, so4 has additional subdomain(s) that are not in the common domain |
PDB Entry: 2bem (more details), 1.55 Å
SCOPe Domain Sequences for d2bemb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bemb_ b.1.18.2 (B:) Chitin-binding protein CBP21 {Serratia marcescens [TaxId: 615]} hgyvespasrayqcklqlntqcgsvqyepqsveglkgfpqagpadghiasadkstffeld qqtptrwnklnlktgpnsftwkltarhsttswryfitkpnwdasqpltrasfdltpfcqf ndggaipaaqvthqcnipadrsgshvilavwdiadtanafyqaidvnlsk
Timeline for d2bemb_: