![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 |
![]() | Protein 11-beta-hydroxysteroid dehydrogenase 1 [117423] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [117424] (29 PDB entries) Uniprot P28845 |
![]() | Domain d2beld1: 2bel D:26-277 [116697] Other proteins in same PDB: d2belc2, d2beld2 complexed with cbo, cl, nap |
PDB Entry: 2bel (more details), 2.11 Å
SCOPe Domain Sequences for d2beld1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2beld1 c.2.1.2 (D:26-277) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} efrpemlqgkkvivtgaskgigremayhlakmgahvvvtarsketlqkvvshclelgaas ahyiagtmedmtfaeqfvaqagklmggldmlilnhitntslnlfhddihhvrksmevnfl syvvltvaalpmlkqsngsivvvsslagkvaypmvaaysaskfaldgffssirkeysvsr vnvsitlcvlglidtetamkavsgivhmqaapkeecaleiikggalrqeevyydsslwtt llirnpcrkile
Timeline for d2beld1:
![]() Domains from other chains: (mouse over for more information) d2bela_, d2belb_, d2belc1, d2belc2 |