![]() | Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) ![]() |
![]() | Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (53 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 |
![]() | Protein 11-beta-hydroxysteroid dehydrogenase 1 [117423] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [117424] (3 PDB entries) |
![]() | Domain d2beld_: 2bel D: [116697] complexed with cbo, cl, nap |
PDB Entry: 2bel (more details), 2.11 Å
SCOP Domain Sequences for d2beld_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2beld_ c.2.1.2 (D:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens)} mefrpemlqgkkvivtgaskgigremayhlakmgahvvvtarsketlqkvvshclelgaa sahyiagtmedmtfaeqfvaqagklmggldmlilnhitntslnlfhddihhvrksmevnf lsyvvltvaalpmlkqsngsivvvsslagkvaypmvaaysaskfaldgffssirkeysvs rvnvsitlcvlglidtetamkavsgivhmqaapkeecaleiikggalrqeevyydsslwt tllirnpcrkile
Timeline for d2beld_: