Lineage for d2belb_ (2bel B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2449736Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 2449763Protein 11-beta-hydroxysteroid dehydrogenase 1 [117423] (3 species)
  7. 2449779Species Human (Homo sapiens) [TaxId:9606] [117424] (29 PDB entries)
    Uniprot P28845
  8. 2449793Domain d2belb_: 2bel B: [116695]
    Other proteins in same PDB: d2belc2, d2beld2
    complexed with cbo, cl, nap

Details for d2belb_

PDB Entry: 2bel (more details), 2.11 Å

PDB Description: structure of human 11-beta-hydroxysteroid dehydrogenase in complex with nadp and carbenoxolone
PDB Compounds: (B:) Corticosteroid 11-beta-dehydrogenase isozyme 1

SCOPe Domain Sequences for d2belb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2belb_ c.2.1.2 (B:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]}
frpemlqgkkvivtgaskgigremayhlakmgahvvvtarsketlqkvvshclelgaasa
hyiagtmedmtfaeqfvaqagklmggldmlilnhitntslnlfhddihhvrksmevnfls
yvvltvaalpmlkqsngsivvvsslagkvaypmvaaysaskfaldgffssirkeysvsrv
nvsitlcvlglidtetamkavsgivhmqaapkeecaleiikggalrqeevyydsslwttl
lirnpcrkile

SCOPe Domain Coordinates for d2belb_:

Click to download the PDB-style file with coordinates for d2belb_.
(The format of our PDB-style files is described here.)

Timeline for d2belb_: