SCOPe 2.05: Domain d1ygfd_: 1ygf D:

Lineage for d1ygfd_ (1ygf D:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin, beta-chain [46500] (24 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46501] (225 PDB entries)
   Uniprot P68871

8. Domain d1ygfd_: 1ygf D: [116693]
   Other proteins in same PDB: d1ygfa_, d1ygfc_
   complexed with hem, oxy

Details for d1ygfd_

PDB Entry: 1ygf, 2.7 Å

PDB Description: t-to-t(high) quaternary transitions in human hemoglobin: betah97a oxy (2mm ihp, 20% peg) (1 test set)

PDB Compounds: (D:) hemoglobin beta chain

SCOPe Domain Sequences for d1ygfd_:

Sequence; same for both SEQRES and ATOM records:

>d1ygfd_ a.1.1.2 (D:) Hemoglobin, beta-chain {Human (Homo sapiens) [TaxId: 9606]}
mhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv
kahgkkvlgafsdglahldnlkgtfatlselhcdklavdpenfrllgnvlvcvlahhfgk
eftppvqaayqkvvagvanalahkyh

Timeline for d1ygfd_:

• d1ygfd_ first appeared in SCOP 1.71
  
• d1ygfd_ appears in SCOPe 2.04
  
• d1ygfd_ appears in SCOPe 2.06
  
• d1ygfd_ appears in the current release, SCOPe 2.08