Lineage for d1ygfd_ (1ygf D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2687001Protein Hemoglobin, beta-chain [46500] (26 species)
  7. 2687135Species Human (Homo sapiens) [TaxId:9606] [46501] (289 PDB entries)
    Uniprot P68871
  8. 2687578Domain d1ygfd_: 1ygf D: [116693]
    Other proteins in same PDB: d1ygfa_, d1ygfc_
    complexed with hem, oxy

Details for d1ygfd_

PDB Entry: 1ygf (more details), 2.7 Å

PDB Description: t-to-t(high) quaternary transitions in human hemoglobin: betah97a oxy (2mm ihp, 20% peg) (1 test set)
PDB Compounds: (D:) hemoglobin beta chain

SCOPe Domain Sequences for d1ygfd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ygfd_ a.1.1.2 (D:) Hemoglobin, beta-chain {Human (Homo sapiens) [TaxId: 9606]}
mhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv
kahgkkvlgafsdglahldnlkgtfatlselhcdklavdpenfrllgnvlvcvlahhfgk
eftppvqaayqkvvagvanalahkyh

SCOPe Domain Coordinates for d1ygfd_:

Click to download the PDB-style file with coordinates for d1ygfd_.
(The format of our PDB-style files is described here.)

Timeline for d1ygfd_: