Lineage for d1yg2a_ (1yg2 A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1720410Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1721437Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1722669Family a.4.5.61: PadR-like [116807] (3 proteins)
    Pfam PF03551; related to the MarR-like family (Pfam PF01047)
  6. 1722670Protein Hypothetical protein AphA [116810] (1 species)
    contains extra C-terminal dimerisation domain
  7. 1722671Species Vibrio cholerae [TaxId:666] [116811] (1 PDB entry)
    Uniprot Q9X399 # "winged helix" domain: 1-87, dimerisation domain: 91-179
  8. 1722672Domain d1yg2a_: 1yg2 A: [116681]
    Structural genomics target

Details for d1yg2a_

PDB Entry: 1yg2 (more details), 2.2 Å

PDB Description: structure of the vibrio cholerae virulence activator apha
PDB Compounds: (A:) gene activator AphA

SCOPe Domain Sequences for d1yg2a_:

Sequence, based on SEQRES records: (download)

>d1yg2a_ a.4.5.61 (A:) Hypothetical protein AphA {Vibrio cholerae [TaxId: 666]}
slphviltvlstrdatgyditkefsasigyfwkashqqvyrelnkmgeqglvtcvlepqe
gkpdrkvysitqagrsalgewfdqptahptvrdefsaklmacsvqsaepyrlqlaelvee
srklvahyqeieaayyanpavldkqqrlerltlrrnllvrqawiqwadevlaelnama

Sequence, based on observed residues (ATOM records): (download)

>d1yg2a_ a.4.5.61 (A:) Hypothetical protein AphA {Vibrio cholerae [TaxId: 666]}
slphviltvlstrdatgyditkefsasigyfwkashqqvyrelnkmgeqglvtcvlevys
itqagrsalgewfdqptahptvrdefsaklmacsvqsaepyrlqlaelveesrklvahyq
eieaayyanpavldkqqrlerltlrrnllvrqawiqwadevlaelnama

SCOPe Domain Coordinates for d1yg2a_:

Click to download the PDB-style file with coordinates for d1yg2a_.
(The format of our PDB-style files is described here.)

Timeline for d1yg2a_: