Lineage for d1yfqa_ (1yfq A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1803012Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 1803160Superfamily b.69.4: WD40 repeat-like [50978] (4 families) (S)
    also contains 8-bladed propellers
  5. 1803276Family b.69.4.2: Cell cycle arrest protein BUB3 [110289] (2 proteins)
    possibly related to the WD-repeat family; both sequence similarity between the blades and the WD40 repeat signature are very weak
    this is a repeat family; one repeat unit is 1u4c A:12-56 found in domain
  6. 1803277Protein Cell cycle arrest protein BUB3 [110290] (1 species)
  7. 1803278Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [110291] (2 PDB entries)
    Uniprot P26449
  8. 1803279Domain d1yfqa_: 1yfq A: [116680]
    complexed with act, ca

Details for d1yfqa_

PDB Entry: 1yfq (more details), 1.1 Å

PDB Description: high resolution s. cerevisiae bub3 mitotic checkpoint protein
PDB Compounds: (A:) Cell cycle arrest protein BUB3

SCOPe Domain Sequences for d1yfqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mqivqieqapkdyisdikiipskslllitswdgsltvykfdiqaknvdllqslrykhpll
ccnfidntdlqiyvgtvqgeilkvdligspsfqaltnneanlgicrickygddkliaasw
dglievidprnygdgviavknlnsnntkvknkiftmdtnssrlivgmnnsqvqwfrlplc
eddngtieesglkyqirdvallpkeqegyacssidgrvaveffddqgddynsskrfafrc
hrlnlkdtnlaypvnsiefsprhkflytagsdgiiscwnlqtrkkiknfakfnedsvvki
acsdnilclatsddtfktnaaidqtielnassiyiifdyenp

SCOPe Domain Coordinates for d1yfqa_:

Click to download the PDB-style file with coordinates for d1yfqa_.
(The format of our PDB-style files is described here.)

Timeline for d1yfqa_: