![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies) consists of seven 4-stranded beta-sheet motifs; meander |
![]() | Superfamily b.69.4: WD40 repeat-like [50978] (4 families) ![]() also contains 8-bladed propellers |
![]() | Family b.69.4.2: Cell cycle arrest protein BUB3 [110289] (2 proteins) possibly related to the WD-repeat family; both sequence similarity between the blades and the WD40 repeat signature are very weak this is a repeat family; one repeat unit is 1u4c A:12-56 found in domain |
![]() | Protein Cell cycle arrest protein BUB3 [110290] (1 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [110291] (2 PDB entries) Uniprot P26449 |
![]() | Domain d1yfqa1: 1yfq A:1-341 [116680] Other proteins in same PDB: d1yfqa2 complexed with act, ca |
PDB Entry: 1yfq (more details), 1.1 Å
SCOPe Domain Sequences for d1yfqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yfqa1 b.69.4.2 (A:1-341) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} mqivqieqapkdyisdikiipskslllitswdgsltvykfdiqaknvdllqslrykhpll ccnfidntdlqiyvgtvqgeilkvdligspsfqaltnneanlgicrickygddkliaasw dglievidprnygdgviavknlnsnntkvknkiftmdtnssrlivgmnnsqvqwfrlplc eddngtieesglkyqirdvallpkeqegyacssidgrvaveffddqgddynsskrfafrc hrlnlkdtnlaypvnsiefsprhkflytagsdgiiscwnlqtrkkiknfakfnedsvvki acsdnilclatsddtfktnaaidqtielnassiyiifdyen
Timeline for d1yfqa1: