Lineage for d1yffd_ (1yff D:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1976411Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1976488Family a.1.1.2: Globins [46463] (27 protein domains)
    Heme-binding protein
  6. 1977385Protein Hemoglobin, beta-chain [46500] (25 species)
  7. 1977509Species Human (Homo sapiens) [TaxId:9606] [46501] (233 PDB entries)
    Uniprot P68871
  8. 1977866Domain d1yffd_: 1yff D: [116675]
    Other proteins in same PDB: d1yffa_, d1yffc_, d1yffe_, d1yffg_
    protein/RNA complex; complexed with cmo, hem, po4

Details for d1yffd_

PDB Entry: 1yff (more details), 2.4 Å

PDB Description: structure of human carbonmonoxyhemoglobin c (beta e6k): two quaternary states (r2 and r3) in one crystal
PDB Compounds: (D:) hemoglobin beta chain

SCOPe Domain Sequences for d1yffd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yffd_ a.1.1.2 (D:) Hemoglobin, beta-chain {Human (Homo sapiens) [TaxId: 9606]}
vhltpkeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv
kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk
eftppvqaayqkvvagvanalahkyh

SCOPe Domain Coordinates for d1yffd_:

Click to download the PDB-style file with coordinates for d1yffd_.
(The format of our PDB-style files is described here.)

Timeline for d1yffd_: