Lineage for d1yffb_ (1yff B:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 530467Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 530468Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 530506Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 531063Protein Hemoglobin, beta-chain [46500] (22 species)
  7. 531125Species Human (Homo sapiens) [TaxId:9606] [46501] (159 PDB entries)
  8. 531393Domain d1yffb_: 1yff B: [116673]
    Other proteins in same PDB: d1yffa_, d1yffc_, d1yffe_, d1yffg_

Details for d1yffb_

PDB Entry: 1yff (more details), 2.4 Å

PDB Description: structure of human carbonmonoxyhemoglobin c (beta e6k): two quaternary states (r2 and r3) in one crystal

SCOP Domain Sequences for d1yffb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yffb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Human (Homo sapiens)}
vhltpkeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv
kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk
eftppvqaayqkvvagvanalahkyh

SCOP Domain Coordinates for d1yffb_:

Click to download the PDB-style file with coordinates for d1yffb_.
(The format of our PDB-style files is described here.)

Timeline for d1yffb_: