SCOPe 2.08: Domain d1yeyd1: 1yey D:184-435

Lineage for d1yeyd1 (1yey D:184-435)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.2: D-glucarate dehydratase-like [51609] (15 proteins)

6. Protein RTS beta protein [117386] (1 species)

7. Species Xanthomonas campestris pv. campestris [TaxId:340] [117387] (1 PDB entry)
   Uniprot Q8P3K2; extended, mainly helical linker between the domains

8. Domain d1yeyd1: 1yey D:184-435 [116670]
   Other proteins in same PDB: d1yeya2, d1yeyb2, d1yeyc2, d1yeyd2
   Structural genomics target
   complexed with mg

Details for d1yeyd1

PDB Entry: 1yey, 2.34 Å

PDB Description: crystal structure of l-fuconate dehydratase from xanthomonas campestris pv. campestris str. atcc 33913

PDB Compounds: (D:) L-fuconate dehydratase

SCOPe Domain Sequences for d1yeyd1:

Sequence; same for both SEQRES and ATOM records:

>d1yeyd1 c.1.11.2 (D:184-435) RTS beta protein {Xanthomonas campestris pv. campestris [TaxId: 340]}
gypayttspgwlgysdeklvrlakeavadgfrtiklkvganvqddirrcrlaraaigpdi
amavdanqrwdvgpaidwmrqlaefdiawieeptspddvlghaairqgitpvpvstgeht
qnrvvfkqllqagavdliqidaarvggvnenlailllaakfgvrvfphaggvglcelvqh
lamadfvaitgkmedraiefvdhlhqhfldpvriqhgrylapevpgfsaemhpasiaefs
ypdgrfwvedla

Timeline for d1yeyd1:

• d1yeyd1 first appeared in SCOP 1.71
  
• d1yeyd1 appears in SCOPe 2.07