![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
![]() | Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) ![]() |
![]() | Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins) C-terminal domain is beta/alpha-barrel |
![]() | Protein RTS beta protein [117929] (1 species) |
![]() | Species Xanthomonas campestris pv. campestris [TaxId:340] [117930] (1 PDB entry) Uniprot Q8P3K2; extended, mainly helical linker between the domains |
![]() | Domain d1yeyc2: 1yey C:2-140 [116669] Other proteins in same PDB: d1yeya1, d1yeyb1, d1yeyc1, d1yeyd1 Structural genomics target complexed with mg |
PDB Entry: 1yey (more details), 2.34 Å
SCOPe Domain Sequences for d1yeyc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yeyc2 d.54.1.1 (C:2-140) RTS beta protein {Xanthomonas campestris pv. campestris [TaxId: 340]} rtiialethdvrfptsreldgsdamnpdpdysaayvvlrtdgaedlagyglvftigrgnd vqtaavaalaehvvglsvdkviadlgafarrltndsqlrwlgpekgvmhmaigavinaaw dlaaraankplwrfiaelt
Timeline for d1yeyc2: