Lineage for d1yeyb2 (1yey B:2-140)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 602849Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 602850Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family) (S)
  5. 602851Family d.54.1.1: Enolase N-terminal domain-like [54827] (12 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 603023Protein RTS beta protein [117929] (1 species)
  7. 603024Species Xanthomonas campestris pv. campestris [TaxId:340] [117930] (1 PDB entry)
  8. 603026Domain d1yeyb2: 1yey B:2-140 [116667]
    Other proteins in same PDB: d1yeya1, d1yeyb1, d1yeyc1, d1yeyd1

Details for d1yeyb2

PDB Entry: 1yey (more details), 2.34 Å

PDB Description: crystal structure of l-fuconate dehydratase from xanthomonas campestris pv. campestris str. atcc 33913

SCOP Domain Sequences for d1yeyb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yeyb2 d.54.1.1 (B:2-140) RTS beta protein {Xanthomonas campestris pv. campestris}
rtiialethdvrfptsreldgsdamnpdpdysaayvvlrtdgaedlagyglvftigrgnd
vqtaavaalaehvvglsvdkviadlgafarrltndsqlrwlgpekgvmhmaigavinaaw
dlaaraankplwrfiaelt

SCOP Domain Coordinates for d1yeyb2:

Click to download the PDB-style file with coordinates for d1yeyb2.
(The format of our PDB-style files is described here.)

Timeline for d1yeyb2: