Lineage for d1yeyb2 (1yey B:2-140)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins)
    C-terminal domain is beta/alpha-barrel
  6. Protein RTS beta protein [117929] (1 species)
  7. Species Xanthomonas campestris pv. campestris [TaxId:340] [117930] (1 PDB entry)
    Uniprot Q8P3K2; extended, mainly helical linker between the domains
  8. Domain d1yeyb2: 1yey B:2-140 [116667]
    Other proteins in same PDB: d1yeya1, d1yeyb1, d1yeyc1, d1yeyd1
    Structural genomics target
    complexed with mg

Details for d1yeyb2

PDB Entry: 1yey (more details), 2.34 Å

PDB Description: crystal structure of l-fuconate dehydratase from xanthomonas campestris pv. campestris str. atcc 33913
PDB Compounds: (B:) L-fuconate dehydratase

SCOPe Domain Sequences for d1yeyb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yeyb2 d.54.1.1 (B:2-140) RTS beta protein {Xanthomonas campestris pv. campestris [TaxId: 340]}
rtiialethdvrfptsreldgsdamnpdpdysaayvvlrtdgaedlagyglvftigrgnd
vqtaavaalaehvvglsvdkviadlgafarrltndsqlrwlgpekgvmhmaigavinaaw
dlaaraankplwrfiaelt

SCOPe Domain Coordinates for d1yeyb2 are not available.

Timeline for d1yeyb2:

Domains from same chain:
(mouse over for more information)
d1yeyb1
Domains from other chains:
(mouse over for more information)
d1yeya1, d1yeya2, d1yeyc1, d1yeyc2, d1yeyd1, d1yeyd2