Lineage for d1yeya1 (1yey A:184-435)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 570217Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 572967Superfamily c.1.11: Enolase C-terminal domain-like [51604] (2 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 573010Family c.1.11.2: D-glucarate dehydratase-like [51609] (11 proteins)
  6. 573141Protein RTS beta protein [117386] (1 species)
  7. 573142Species Xanthomonas campestris pv. campestris [TaxId:340] [117387] (1 PDB entry)
  8. 573143Domain d1yeya1: 1yey A:184-435 [116664]
    Other proteins in same PDB: d1yeya2, d1yeyb2, d1yeyc2, d1yeyd2

Details for d1yeya1

PDB Entry: 1yey (more details), 2.34 Å

PDB Description: crystal structure of l-fuconate dehydratase from xanthomonas campestris pv. campestris str. atcc 33913

SCOP Domain Sequences for d1yeya1:

Sequence, based on SEQRES records: (download)

>d1yeya1 c.1.11.2 (A:184-435) RTS beta protein {Xanthomonas campestris pv. campestris}
gypayttspgwlgysdeklvrlakeavadgfrtiklkvganvqddirrcrlaraaigpdi
amavdanqrwdvgpaidwmrqlaefdiawieeptspddvlghaairqgitpvpvstgeht
qnrvvfkqllqagavdliqidaarvggvnenlailllaakfgvrvfphaggvglcelvqh
lamadfvaitgkmedraiefvdhlhqhfldpvriqhgrylapevpgfsaemhpasiaefs
ypdgrfwvedla

Sequence, based on observed residues (ATOM records): (download)

>d1yeya1 c.1.11.2 (A:184-435) RTS beta protein {Xanthomonas campestris pv. campestris}
gypayttspgwdeklvrlakeavadgfrtiklkvganvqddirrcrlaraaigpdiamav
danqrwdvgpaidwmrqlaefdiawieeptspddvlghaairqgitpvpvstgehtqnrv
vfkqllqagavdliqidaarvggvnenlailllaakfgvrvfphaggvglcelvqhlama
dfvaitgkmedraiefvdhlhqhfldpvriqhgrylapevpgfsaemhpasiaefsypdg
rfwvedla

SCOP Domain Coordinates for d1yeya1:

Click to download the PDB-style file with coordinates for d1yeya1.
(The format of our PDB-style files is described here.)

Timeline for d1yeya1: