SCOPe 2.01: Domain d1yeub_: 1yeu B:

Lineage for d1yeub_ (1yeu B:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin, beta-chain [46500] (25 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46501] (196 PDB entries)
   Uniprot P68871

8. Domain d1yeub_: 1yeu B: [116657]
   Other proteins in same PDB: d1yeua_, d1yeuc_
   complexed with hem, oxy

Details for d1yeub_

PDB Entry: 1yeu, 2.12 Å

PDB Description: t-to-t(high) quaternary transitions in human hemoglobin: betaw37g oxy (10 test sets)

PDB Compounds: (B:) hemoglobin beta chain

SCOPe Domain Sequences for d1yeub_:

Sequence; same for both SEQRES and ATOM records:

>d1yeub_ a.1.1.2 (B:) Hemoglobin, beta-chain {Human (Homo sapiens) [TaxId: 9606]}
mhltpeeksavtalwgkvnvdevggealgrllvvypgtqrffesfgdlstpdavmgnpkv
kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk
eftppvqaayqkvvagvanalahkyh

Timeline for d1yeub_:

• d1yeub_ first appeared in SCOP 1.71
  
• d1yeub_ appears in SCOP 1.75
  
• d1yeub_ appears in SCOPe 2.02
  
• d1yeub_ appears in the current release, SCOPe 2.08