Lineage for d1yemb_ (1yem B:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 726324Fold d.63: CYTH-like phosphatases [55153] (1 superfamily)
    duplication of beta-alpha-beta(3) motif: antiparallel beta sheet forms wide barrel (n=8, S=16) with a channel running through it
  4. 726325Superfamily d.63.1: CYTH-like phosphatases [55154] (2 families) (S)
  5. 726335Family d.63.1.2: CYTH domain [118007] (3 proteins)
    Pfam PF01928
  6. 726340Protein Hypothetical protein PF0863 [118008] (1 species)
  7. 726341Species Pyrococcus furiosus [TaxId:2261] [118009] (1 PDB entry)
  8. 726343Domain d1yemb_: 1yem B: [116647]
    Structural genomics target
    complexed with pt, unx

Details for d1yemb_

PDB Entry: 1yem (more details), 2.3 Å

PDB Description: conserved hypothetical protein pfu-838710-001 from pyrococcus furiosus
PDB Compounds: (B:) hypothetical protein

SCOP Domain Sequences for d1yemb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yemb_ d.63.1.2 (B:) Hypothetical protein PF0863 {Pyrococcus furiosus [TaxId: 2261]}
seveikfkikledflhtlntfnpefvryeeqedvyfevprpkllrirgvhnlkkyyltfk
eildenneefyevefeigdfekavevfkrlgfkiqatikkkrwvyklngvtlevnrvegi
gdfvdievisdspeeakekiwevakmlglkeedveprlylelinel

SCOP Domain Coordinates for d1yemb_:

Click to download the PDB-style file with coordinates for d1yemb_.
(The format of our PDB-style files is described here.)

Timeline for d1yemb_: